PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03751g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 231aa    MW: 26396.2 Da    PI: 9.8001
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03751g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.83.3e-1798151957
                               HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                               ++q+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Niben101Scf03751g00003.1  98 SSQIGILEMLYRGgMRTPNAHQIEQITEQLgkygKIEGKNVFYWFQNHKARERQ 151
                               68**********99**************************************97 PP

2Wus_type_Homeobox98.84.1e-32981531065
         Wus_type_Homeobox  10 peQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                               ++Qi iLe+ly+ G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
  Niben101Scf03751g00003.1  98 SSQIGILEMLYRGGMRTPNAHQIEQITEQLGKYGKIEGKNVFYWFQNHKARERQKQ 153
                               57****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.1E-484156IPR001356Homeobox domain
CDDcd000860.0015388153No hitNo description
PfamPF000466.1E-1598151IPR001356Homeobox domain
SuperFamilySSF466894.82E-1098157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-698151IPR009057Homeodomain-like
PROSITE profilePS500719.523100152IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLLPVVIALL YNGGSSIFKT PNPPMYMGMK VHQFTRGLML EHDSAAPSLT LGCKRLRPLA  60
PKLSSCTNHP TIHVKSFIRP ESSTSSAKTS FNDDKKDSSQ IGILEMLYRG GMRTPNAHQI  120
EQITEQLGKY GKIEGKNVFY WFQNHKARER QKQKRNSLGL SPSPRTPPPI VTSPLSFDTR  180
GEVVRGEDSP YKRKCRDWTY EYLEEEEKRN CREDNGDRTL ELFPLHPEGM R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488708.11e-136PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J96e-55WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLC0IN091e-114C0IN09_PETHY; WOX4
STRINGPGSC0003DMT4000206621e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61862335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.14e-56WUSCHEL related homeobox 4